PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0801s0090.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 283aa    MW: 32689.9 Da    PI: 8.9486
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0801s0090.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.61.4e-54101351128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lppGfrFhPtdeel+v+yL++++ ++++++ ++i+evdiyk++Pw+Lp+k++ +e+ewyfF++rd+ky++g r+nrat sgyWkatg
  SapurV1A.0801s0090.1.p  10 LPPGFRFHPTDEELIVHYLRNQAISRPCPA-SIIPEVDIYKFDPWQLPEKAEFGENEWYFFTPRDRKYPNGVRPNRATVSGYWKATG 95 
                             79****************************.89***************99999********************************** PP

                     NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             +dk+++s +++ vg+kk Lvfykgr pkg+ktdW+mheyrl
  SapurV1A.0801s0090.1.p  96 TDKAIHS-GSKYVGVKKALVFYKGRPPKGTKTDWIMHEYRL 135
                             *******.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.22E-667161IPR003441NAC domain
PROSITE profilePS5100561.61910161IPR003441NAC domain
PfamPF023652.7E-2711135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009825Biological Processmultidimensional cell growth
GO:0009835Biological Processfruit ripening
GO:0009908Biological Processflower development
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MQGKTSYNQL PPGFRFHPTD EELIVHYLRN QAISRPCPAS IIPEVDIYKF DPWQLPEKAE  60
FGENEWYFFT PRDRKYPNGV RPNRATVSGY WKATGTDKAI HSGSKYVGVK KALVFYKGRP  120
PKGTKTDWIM HEYRLNDPRK QARQNGSMRL DDWVLCRIYK KRHTVRQLEE KTENTVDAHM  180
DVTPANDASD LQMMKFERTC SLSHLLELEY LGSISELLSG DTYNSNLDFQ NLMNNARTDQ  240
VEKIQLGQMS PQHTDRGKFQ GNQQGSTLNQ PLFVNPTMYG FQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D5e-741016720174NAC domain-containing protein 19
3swp_C5e-741016720174NAC domain-containing protein 19
3swp_B5e-741016720174NAC domain-containing protein 19
3swp_A5e-741016720174NAC domain-containing protein 19
3swm_D5e-741016720174NAC domain-containing protein 19
3swm_C5e-741016720174NAC domain-containing protein 19
3swm_B5e-741016720174NAC domain-containing protein 19
3swm_A5e-741016720174NAC domain-containing protein 19
4dul_B6e-741016717171NAC domain-containing protein 19
4dul_A6e-741016717171NAC domain-containing protein 19
1ut7_B6e-741016717171NO APICAL MERISTEM PROTEIN
1ut7_A6e-741016717171NO APICAL MERISTEM PROTEIN
1ut4_B6e-741016717171NO APICAL MERISTEM PROTEIN
1ut4_A6e-741016717171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00221DAPTransfer from AT1G69490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1827097e-90AC182709.2 Populus trichocarpa clone Pop1-85D11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002312256.20.0hypothetical protein POPTR_0008s08850g
SwissprotO492551e-112NAC29_ARATH; NAC transcription factor 29
TrEMBLB9HI900.0B9HI90_POPTR; Uncharacterized protein
STRINGPOPTR_0008s08850.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41033262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-113NAC-like, activated by AP3/PI